2.20 Rating by ClearWebStats
spredtechnologies.com is 5 years 4 days 15 hours old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, spredtechnologies.com is SAFE to browse.
Get Custom Widget

Traffic Report of Spredtechnologies

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View spredtechnologies.com site advisor rating Not Applicable

Where is spredtechnologies.com server located?

Hosted IP Address:

143.95.225.99 View other site hosted with spredtechnologies.com

Hosted Country:

spredtechnologies.com hosted country US spredtechnologies.com hosted country

Location Latitude:

34.0549

Location Longitude:

-118.2578

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View spredtechnologies.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 143.95.225.99)

Antalya Adaklık Kurbanlık - 7/24 İletişim İçin 0553 402 0740

spredtechnologies.com favicon - antalya-adaklikkurbanlik.com

View spredtechnologies.com Pagerank   spredtechnologies.com alexa rank Not Applicable   spredtechnologies.com website value $ 8.95

Antalya En Yakın Lastikçi - 7/24 Mobil Lastikçi 0 542 611 69 87 Arayın

spredtechnologies.com favicon - antalyaenyakinlastikci.com

View spredtechnologies.com Pagerank   spredtechnologies.com alexa rank Not Applicable   spredtechnologies.com website value $ 8.95

Abdullah Saeed – All the latest article

spredtechnologies.com favicon - abdullahblog.com

View spredtechnologies.com Pagerank   spredtechnologies.com alexa rank Not Applicable   spredtechnologies.com website value $ 8.95

Antalya Sepetli Vinç Kiralama - İletişim İçin : 0543 875 3833

spredtechnologies.com favicon - antalyaenessepetlivinckiralama.com

View spredtechnologies.com Pagerank   spredtechnologies.com alexa rank Not Applicable   spredtechnologies.com website value $ 8.95

KGN Travels - Coming Soon

spredtechnologies.com favicon - kgntravels.lk

View spredtechnologies.com Pagerank   spredtechnologies.com alexa rank Not Applicable   spredtechnologies.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.16.0
Date: Fri, 17 May 2019 06:47:38 GMT
Content-Type: text/html;charset=ISO-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip

Domain Information for spredtechnologies.com

Domain Registrar: INTERNET DOMAIN SERVICE BS CORP spredtechnologies.com registrar info
Registration Date: 2019-05-15 5 years 4 days 15 hours ago
Last Modified: 2019-05-15 5 years 4 days 15 hours ago

Domain Nameserver Information

Host IP Address Country
dns.site5.com spredtechnologies.com name server information 162.215.1.172 spredtechnologies.com server is located in United States United States
dns2.site5.com spredtechnologies.com name server information 162.215.1.178 spredtechnologies.com server is located in United States United States
ns1.webserversystems.com spredtechnologies.com name server information 162.214.130.211 spredtechnologies.com server is located in United States United States
ns2.webserversystems.com spredtechnologies.com name server information 162.214.129.93 spredtechnologies.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
spredtechnologies.com A 21599 IP:143.95.225.99
spredtechnologies.com NS 21599 Target:dns.site5.com
spredtechnologies.com NS 21599 Target:dns2.site5.com
spredtechnologies.com NS 21599 Target:ns1.webserversystems.com
spredtechnologies.com NS 21599 Target:ns2.webserversystems.com
spredtechnologies.com SOA 21599 MNAME:ns2.webserversystems.com
RNAME:mugisolo.gmail.com
Serial:2019051403
Refresh:86400
Retry:7200
Expire:3600000
spredtechnologies.com MX 21599 Target:mail.spredtechnologies.com
spredtechnologies.com TXT 21599 TXT:v=spf1 +a +mx +ip4:174.136.12.204
+include:relay.mailchannels.net
+include:websitewelcome.com ~all

Similarly Ranked Websites to Spredtechnologies

Google

spredtechnologies.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View spredtechnologies.com Pagerank   Alexa rank for spredtechnologies.com 1   website value of spredtechnologies.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

spredtechnologies.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View spredtechnologies.com Pagerank   Alexa rank for spredtechnologies.com 1   website value of spredtechnologies.com $ 8,833,062,960.00

Gmail

spredtechnologies.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View spredtechnologies.com Pagerank   Alexa rank for spredtechnologies.com 1   website value of spredtechnologies.com $ 8,833,062,960.00

Android Apps on Google Play

spredtechnologies.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View spredtechnologies.com Pagerank   Alexa rank for spredtechnologies.com 1   website value of spredtechnologies.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

spredtechnologies.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View spredtechnologies.com Pagerank   Alexa rank for spredtechnologies.com 1   website value of spredtechnologies.com $ 8,833,062,960.00

Full WHOIS Lookup for spredtechnologies.com

Domain Name: SPREDTECHNOLOGIES.COM
Registry Domain ID: 2391030898_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.internet.bs
Registrar URL: http://www.internet.bs
Updated Date: 2019-05-15T06:48:52Z
Creation Date: 2019-05-15T06:28:57Z
Registry Expiry Date: 2020-05-15T06:28:57Z
Registrar: Internet Domain Service BS Corp
Registrar IANA ID: 2487
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: DNS.SITE5.COM
Name Server: DNS2.SITE5.COM
Name Server: NS1.WEBSERVERSYSTEMS.COM
Name Server: NS2.WEBSERVERSYSTEMS.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-05-17T06:47:26Z